Myths Of The Near Future

Filed in ASTROLOGY

Female Astronaut Chinese Avant Garde Photography

So this is what a Full Moon during the rev-up to the strongest “hit” of the Zap Zone feels like…

Work, being unable to duck evolution because it is either that or a practically daily devolution,ย  more work and/or struggling to maintain relevancy – i have never known or being hearing of so many talented and fully professional people having work issues than i have at the moment. Maybe it is because bubble economies prefer to digitally create fake money to loan out than to employ good people.ย  If you are feeling this, keep the faith, Operation Awe is just beginning.

AND maybe this is just me, but I am developing some psycho-obsession with MH370.ย  The Zero Hedge take on it is, obviously, interesting. All I know is what you guys know – flying toward the Andaman Islands is just the latest in a series of w.t.f.s – but i will say two things: When it first happened, i had the strongest vibe that it was not like an “ordinary” aviation malfunction. That it was bigger and weirder, an actual Zap Zone event. Well that’s playing out. And someone who is informed in such matters said to me right at the beginning that she thought it was an extremely skilled hijacking, something state backed.

It was a surreal day – i had to get an emergency skin check up at the derm as i had a melanoma once and this new thing on me looked scary – f.y.i. i am fine – me and the site will live on lol – BUT how funny is this; standing naked under super lurid bright lights in the room with a handsome Virgo dermatologist wearing massive magnifying glasses going over my whole body looking for defects was like so apt for the Full Moon in Virgo…

THANK FUQ For Venus in Aquarius & Retro-Mars – the superior powers of detachment they bestow are something to behold. Access them for any sort of Art-Aesthetics-Romance assessment and you will be stunned.

Thoughts?

Image: Chen Man – click to read fab article re her.

The title of the post is from this amazing J.G. Ballard book – I mean seriously w.t.f – he was SO PROPHETIC. Madly Scorpio.

BallardMyths

Access Horoscopes, Insta-Tarot, Oracle & more

Join the thousands of happy Mega Mystic members, who are enjoying Mysticโ€™s unique, modern and empowering take on the ancient art of horoscopes & all things Astrology. With an all-access membership

250
Leave a Reply

avatar
44 Comment threads
206 Thread replies
0 Followers
 
Most reacted comment
Hottest comment thread
52 Comment authors
Baristagemsweetpeadavidlkatsweetpsweetpeaea Recent comment authors
newest oldest most voted
Saggibee
Saggibee

Ugh, I have the most painful blind pimple on my jaw at the moment. I’m just moving through a process of icing it to get the inflammation down and then smothering Payot’s Pate Grise on top of it in the hope it will look like less of a 2nd head growing out of my neck at work tomorrow. Well, wow! I’ve been a bit more switched off from the wider world lately as a lot has been happening in my own life – the last twelve months have really been all evolution, no way of ignoring it. The latest, I… Read more »

Chrysalis
Chrysalis

Well! The building full moon has sent the Weatherbeaten Virgo completely batshit crazy. Just when I was beginning to really warm to him, a hooch-fuelled emo outburst/breakdown (his not mine) had me fleeing his house in the dead of night dodging simultaneous narky pass-agg insults and teary declarations of undying love.

Last I saw him he was standing in the dim light refilling his glass with whisky telling me that he ‘never drinks whisky’ and *this* – is the effect I have on men.’ Fuq!

calypso
calypso

oh fuq, yeah, well, what do you do Chrys? you better save him the trouble of your company!

jokes, but seriously, sorry to hear that ๐Ÿ™

Chrysalis
Chrysalis

I know huh… oh well. I am counting this as a chance to practise my newfound relationship policy and just walk away and forget about it. I’ll miss the sex tho’ ๐Ÿ™‚

calypso
calypso

yes, excellent approach and I’m sure there’ll be more sex and it’s fun to try it with more different people ๐Ÿ™‚

Andro
Andro

Hope you are feeling better now Chrys, that must’ve been a hell of a shock.
Pity, but at least you both had some fun before his frailties revealed themselves?
This Moon..

Chrysalis
Chrysalis

I was actually frightened, it was horrible. I expect he is feeling pretty bad this morning. I feel for him, I do like him a lot but this episode has shown me that my boundaries really are cast iron. Years ago I would have probably attempted to ‘work on it’ but not now. Have already deleted everything and am doing extreme laundry as we speak.

Andro
Andro

Doing laundry can be very soothing, that would have freaked me out a bit too Chrys. Take it easy, xx.
Love Prowln’s analogy there. ๐Ÿ™‚

12th house virgo
12th house virgo

This so resonates with how things went with me and Pisces. From bliss to no-f-ing-way-will-I-budge-on-this. Surprised me to know I am strong. I am happy for it though. Its a shock to the system, for sure. Must be in the astro, 12th/6th house axis: borders

prowlncrab
prowlncrab

Virgo’s and drunkenness are never a good look … it’s one sign that just does not suit being under the influence of the hooch. Kinda like a Vulcan starring on The Bold & The Beautiful … totally wrong.

Chrysalis
Chrysalis

Totally agree Prowln….that’s an excellent analogy

12th house virgo
12th house virgo

Please tell me Virgos are allowed dream weed

prowlncrab
prowlncrab

oh yes that is the Virgo drug of choice – slows down the hyper analytic mental processes so they can smell the roses for a bit. Though I wouldn’t recommend it as a long term relaxation strategy … stoners are so annoying! ๐Ÿ˜‰

Scorpbot
Scorpbot

“and *this* โ€“ is the effect I have on men.โ€™ Fuq!”

Noooo! it’s not YOU, it’s just typical of the “quality” of men on internet dating sites.

Lucky you saw his true colours sooner than later!

At least you cleared the cobwebs ๐Ÿ™‚

calypso
calypso

totally, but now smoke your yoni while the washing is doing it’s thing ๐Ÿ˜‰

Andromeda
Andromeda

Am thinking a Virgo Moon really is a ‘smoke-yer-yoni’ moon with all these. I really think Athena should rule Virgo though and I don’t know that she ever needed her Yoni smoked.

Chrysalis
Chrysalis

Oh yes. Not a cobweb left up there now lol

I am finding though that most of the blokes I am in contact with are describing me as some kind of drug at the mo. It’s most perplexing. I have Neptune on my sun stellium. Perhaps I need to lock myself away at a yoga ranch until 2016 for the good of bloke-kind??? ๐Ÿ™‚

12th house virgo
12th house virgo

Are you sure he’s not a Pisces?

Blue Moon
Blue Moon

Oh Prowin you are SO right re Virgo’s and alcohol. We make saddest looking drunks EVER. Just messy does not suit us at all.
Chrys this is a bad experience. I’m sorry it happened but Scorp bot makes a good point.
Plenty o fish (terrible analogy) but you know.. Shields up. Extreme laundry is totally your best defence now. Just move on xxx

Chrysalis
Chrysalis

Thanks hon’. I am moving onwards immediately. Not looking back xx

Chrysalis
Chrysalis

Four planets in Virgo – don’t know birth time but perhaps Pisces rising.
So I can get max astro points from this loser here are some other facts for you all:
– last night he confessed to a compulsive flossing habit and that he has up to six packets around the house at once
– Venus in Leo – he has two hairdryers and multiple hair products.

davidl
davidl

Last night I had an interesting dream. Full color and particularly detailed. I was piloting a large passenger plane. A bearded man who looked a bit like a mountain climber next to me. My first thought was …hmmm … I don’t know how to land this thing.but when I looked at my co pilot I realized he couldn’t either. Over the horizon and as far as I could see below was a rocky barren desert. The next thought was ok we are near our landing place and started to work out how to slow the plane for descent. I pulled… Read more »

Andro
Andro

Ascension? Nice dream. ๐Ÿ™‚

Veronica
Veronica

I hope that’s what happens to the passengers of the kidnapped plane, that they at least safely let go those that are not electronics experts.

Andro
Andro

Yes, I think we are all hoping there is lovely island worthy of a Bond villain, with a landing strip inside a volcano, where all are safe and sound and about to emerge from and come home.

12th house virgo
12th house virgo

I was thinking today perhaps Scepter is at work again and the passengers of the missing plan have all been given costumes and cocktails. My Libra stellium loves the symmetry of the Bond world.

Scorporation, Inc.
Scorporation, Inc.

This is so vaginal! Whatever is the vagina term, like phallic = penis? Pink Freud, total vagina.

Blue Moon
Blue Moon

Great question Scorp inc. What IS the Vagina Term?

calypso
calypso

yonic!

ps. Blue, yes, tough spot you’re in….either way, you’ll be fine, time will pass, things will shift xx

calypso
calypso

can you get a room in a backpackers for one night?

Blue Moon
Blue Moon

Easily but that would be running away. My intention is not to do that because that is my old pattern. I may not be able to hold out until Monday evening but I want to try..

calypso
calypso

yeah I get that although in my past sticking shit things out hasn’t often been a good choice. however, your situation, you know what it looks like, I’m just watching on from Oz and hoping you can sort it x

Blue Moon
Blue Moon

Yonic. Wow love that Calypso.
Brilliant! Haha
My biggest concern right now is having 10% of battery power on my iPad and no adapter. But if I need to move I can. I have legs, cash and there are always cabs, hotels, etc. it will be ok. If nothing else I will learn more how to deal with my own chaos and drama creation habit a little better. Starting to feel a bit detached, dreamy and serene. Like, “this too shall pass. Just breathe.” Thanks for your helpful comments btw

Scorporation, Inc.
Scorporation, Inc.

Yonic! *fab* Thanks, calypso love xx

Scorporation, Inc.
Scorporation, Inc.

Davidl, epic yonic symbolism here. Yoni abounds, bountiful & protective. Yoni kingdom.

Blue Moon
Blue Moon

Wow
Totally amazing dream. That is epic imagery. Feel physically lighter in my cells reading that. Will hold on to that image. I like it a lot. Thanks for sharing. I don’t know why but it helps me. Feels like a “community dream” if that makes sense.
Anyway thanks, it helps me.

davidl
davidl

I reckon the plane is in southern Mongolia

sweetpea
sweetpea

Oh dear ๐Ÿ˜†

Andro
Andro

Soz about the yakkety yak, the full moon is on my 3rd House/Mars!

Combined with Saturn on my Moon, but exactly, then Mars on my natal Uranus… Well, themes of inner war and outer wars and powerful feelings keep surging up.
I found this Janis quote so true:

“Being an intellectual creates a lot of questions and no answers. You can fill your life up with ideas and still go home lonely. All you really have that really matters are feelings. That’s what music is to me.”

Janis has Leo DC, Cancer Moon, we woulda been super pals, imo! ๐Ÿ˜‰

sweetpea
sweetpea

An upside to the impending zz is that just today made my last payment for a past tax bill to the State of California. The Federal is another thing, but step by step I’m fixing things. It’s worth playing this game for the sake of my peace of mind. I don’t for one second think this government deserves to manage ~my~ money however and the Feds will get what they get when I fell like giving it. If they give me one second of grief I will get a lawyer. The Feds actually leave you alone when they feel they… Read more »

sweetpea
sweetpea

Fuqin sick

sweetpea
sweetpea

I said all of that above as a woman alone, basically.

Course I have David, my Kataka condomate.

He could save me but he don’t always got his teeth in..

:mrgreen:

Andro
Andro

This is part of the reason I became an omnivore again Sweetpea. Vegetarians might argue that eating plants is ok, that plants don’t have a central nervous system, so they don’t feel pain – but it’s not true. I talk to trees, they DO feel pain and fear. I mean we can talk to everything, we can talk to our livers, to flowers and bugs.. even the bacteria in our intestines. The Universe is predatory is .. well it’s true, but that is the wrong vibe to bring to it, it sounds so dark. The truth is that to live… Read more »

sweetpea
sweetpea

On a fundemental level in the here and now3d, I agree. But Source gave everyone what they need, originally. It is only ego that feels lack and is the demise of us. We are currently seeing this played out as many would rather seek without, rather than within. Like I said, “decisions, decisions”… “Mankind will be given a choice as to what they consider is their high faith”. I think we might take solace in what my teacher said ‘we are just starting”…There is much room for transition and “trial and error”…as the angels called it. Your posts are so… Read more »

Andro
Andro

Thank you kind Pea. Actually, I have changed since I first started here immensely, you are right. The last 5 years, I look back and I really don’t even know who that chick before was anymore.. Actually I don’t even care or relate to her! She’s just ..gone. Different body, name, address, energy signature..

I like your angel’s lessons, very “I’ve learned so much from my mistakes, I’m thinking of making a few more”, lol. xx.

Baristagem
Baristagem

You guys should read this, it’s long but so fascinating! http://www.newyorker.com/reporting/2013/12/23/131223fa_fact_pollan?currentPage=all I became a fake vego (pescatarian) nearly two years ago & after reading this article I felt a little confused but then found a “little” comfort in reading that plants have adapted themselves to be consumed. I’m not sure if animals can do that in the same way & I just find it hard to eat anything with eyelashes. So I will keep on being a fake vego, for lots of reasons but mainly because it just feels better for me personally. BTW I have no idea what you… Read more »

Andro
Andro

That’s an awesome link BGem! Thank you for posting that, ๐Ÿ˜€ . I no longer know what we are talking about either… xx.

starlore
starlore

Your son-in-law said some interesting things Sweetpea. Personally, I think meditation in the answer. We can’t respond to violence with violence anymore. It simply doesn’t work. And if one raises one’s vibration the bad stuff just doesn’t touch you. Though it is good to know what is going on in the collective. Re eating animals, vegetables etc, my third eye occasionally really opens up when I’m eating. The first time it happened I was eating some tuna and the actual fish presented itself before me in my inner vision. Of course I immediately apologized and said how sorry I was,… Read more »

Andromeda
Andromeda

Yes, Star, I do that too! Everything touched/eaten/thought of is a door to another experience. The animals and plants connect us to another experience through their being part of us. Our beautiful vehicles through space and time that our bodies are, it truly is a miracle to be able to experience that connection with our world. Beautiful.

sweetpea
sweetpea

On another note Andy,

I get what you mean, but higher powers so to speak do not need to be predator to share their energy or wisdom…another words, to take you to a higher level of consciousness…They already are already.

Our experience may enrich them, as we are an aspect of them, but it does not entail them being a predator. That is absolutely a humanistic characteristic.

And very Shamanistic..I love Shamans..I am one but of the Christ Light…

Teacher said there are very few of those…So easy to get lost in the 3d mumbo jumbo.

sweetpea
sweetpea

You guys posted while i was positng mine…Let me read yours and come back, k?

Suddenly I feel like cryin…x

Andromeda
Andromeda

Aw Sweetle Beetle! Why cry, you ok?
I don’t think of those higher frequency beings as having such a predatory aspect either. I was more thinking of the nature of this reality where we incarnate in flesh. It’s kind of like a horror movie here, but we can make it really wonderful too. ๐Ÿ˜‰ We are at home whether we are incarnating there or here, it’s all our home, no one is better than anyone else, no?! Mmwah.

sweetpea
sweetpea

No hon, I know when something is full of shit.. bye bye.

Andro
Andro

Omg, wow ๐Ÿ™ . Truly I don’t know what I said to offend you Sweetpea..

starlore
starlore

I think I can see why she was upset with you, and I’m sure you will be able to work it out too.

Andro
Andro

Btw, meant to say, “noWHERE is better than anywhere else”. But same same…

Andromeda
Andromeda

http://www.youtube.com/watch?v=zVFChOcPFWs&list=WLej5vWE1qC-edJb5bPsdGVyK9wuLm7Y7z

S.Pea – I thought you might like this. I thought the end was really beautiful, please accept it by way of a peacemaking effort!
If my comments were too heavy I do apologise, I was inspired by yr comments & was agreeing with your notions & just thought I was expanding on them. If Starlore sees I have offended, then I have clearly expressed myself poorly, even if I can’t see it. Truly I am woefully obtuse at times at picking up on how others might see my comments at times…

starlore
starlore

You’re sweet. I’m sure you never meant to offend. It’s hard for all of us to convey the right tone at times.
Deep bows to you all.

sweetpsweetpeaea
sweetpsweetpeaea

Hey guys, so weet of you both. I’d actually had some wine and so was a bit sensitive.

Gemmy, if you read this perhaps I wasn’t sure what I was talking about either…I mean a bit…lol..
I will take a look at the link Andy and than you Starlore. Thank you Starlore. Perhaps Cardinals right now a a bit edgy or implulsive. I’m not usually unless I’ve had some wine…

xo

Baristagem
Baristagem

So sorry sweetpea! I didn’t mean that at all! I meant I was butting in on the convo without first reading why you guys were talking about vegetarianism, which you weren’t, Andy was. Also, so very sickly yesterday (as you know from new comment reply today. So sorry sweetpea!! I would never disrespect you in any way, ever. You’re like my ma, you’d WHOOP MA’ ASS, am I right????

sweetpea
sweetpea

hh
haha, I’d actually taken your comment as a joke. x

Baristagem
Baristagem

Lol! xxxxx

Scorporation, Inc.
Scorporation, Inc.

Full moon lighting the backwards path of Mars in my 7th house. Yesterday I traveled a stretch of road that saw a miles-long pile-up of traffic just two days earlier: hundreds of people involved, scores injured, 3 dead. Crews were still out removing vehicles and debris as I drove through. The energy lingering there is palpable. Took all night to shake the little magnetic bits off me… Also in my 7th are natal Pluto-Moon and Persephone opp my AC-Jupiter (where Neptune is now). So yeah: shiz is loaded. A Virgo sun elder said to me (also yesterday) as if having… Read more »

sweetpea
sweetpea

Was just thinking of posting a quip “in lieu of saving the world, I am going to go get a coffee and go to the pool.” Perhaps that is my Aries ZZ talking and that I often don’t feel I’m doing enough but then I think “I’m here in this shit, ain’t I?” And I do work my arse off for others. Perhaps it’s the way I see the world and maybe Aries selfishness too…I don’t think so tho, I am not selfish…but I have never felt survivor’s guilt. Can see your point tho feeling the aftermath of a large… Read more »

Scorporation, Inc.
Scorporation, Inc.

Ah, Palm Springs! Gorgeousness: wish I was there, Sweetpea ๐Ÿ™‚ My Virgo elder was referring to my professional industry. Industry: sounds funny to call health care such, especially my little socialized-med reef, but that’s what it is here. I’m on a reef in an otherwise toxic ocean of privatization & capitalism. “They are using you.” Well, yeah– that’s the way this shiz works, right? *eye roll, bee buzz* bzzzz I think for me, like with any good grief process, the happening of loss reawakens feelings of past losses. Doubly so thanks to rx Mars + full moon in my 7th… Read more »

sweetpea
sweetpea

Haha, I am going to use the super duper strong jets at the jacuzzi for my hydro therapy. Funny thing is, I have to use my snorkle to go underwater and get the neck parts. Talk about looking like a moron. And, I just colored my hair the other day so will wear a bathing cap, ah, the beauty of it all ๐Ÿ™‚

But if I could help I would! If only the whole world could get a massage…would be a much less stressful place. x

Scorporation, Inc.
Scorporation, Inc.

Lol! Enjoy your dive! I must get myself this kind of support, hydro tx, massage, something. Think I’ll hook myself up this week!

International Massage Day: heaven on Earth *sigh*

Thanks, Sweetpea x

Scorporation, Inc.
Scorporation, Inc.

— he meant one thing in particular, my Virgo elder. But I was thinking that & then some. I mean, Scorp Inc is a conglomerate, and we are finding a few unsavory biz characters in our midst…

But Spring is coming. Spring’s coming.

Scorporation, Inc.
Scorporation, Inc.

Oh– no, you are not selfish in the least, Sweetpea! You have Resilience. And it’s beautiful. xx

Blue Moon
Blue Moon

Survivor guilt. Check
Totally!
WTF is that about please?
I have been SO aware of this since it happened.
I had the same thing in NY during 9/11 and my PTS seemed to be more related to that than actual fears for my own safety. Very strange and unnerving

Scorporation, Inc.
Scorporation, Inc.

Survivor guilt is simply a feature of Grief for many of us. When we experience a new loss, our fresh grief can drudge up old grief, and for some of us that means survivor guilt, too. Of course, a Virgo Full Moon totally helps with the proclivity for guilt, too, right? lol And the rx Mars bit + many of us have Pluto natally here… It’s a perfect storm. What is true about the grief process is also true of PTS in that new trauma can trigger old trauma right along with it. All aboard! I really could do with… Read more »

Blue Moon
Blue Moon

Oh gawd have been CRAVING a massage for MONTHS. Time to give my body what it wants. Things are going to change when I get home from this trip. Thanks for the info re grief. I know my guilt stuff is tied in with dismissing much of what hurt me as a kid by thinking “well I’m a white South African so what right do I have to feel hurt?” You know when others had it so much tougher. Was a way of invalidating my own pain. Yes. This fits. Thank you xx

Andro
Andro

“and this is not Scorpio mating call here, ok?” Scorp Inc, ๐Ÿ˜€ you the best!

Scorporation, Inc.
Scorporation, Inc.

Not that I’m opposed to some sooky nooky, but, you know : P

calypso
calypso

sooky nooky, hehehe, I love that ๐Ÿ˜€

Quadrupled
Quadrupled

Glad to read that you are OK Mystic! much love xoxo

(cannot comment these days — was depressed, now clawing my way back up).

sweetpea
sweetpea

Sorry to hear you have been depressed Q. Yes,keep clawin’ girl..x

12th house virog
12th house virog

Glad to hear you are making your way out! xo

Patti/Skyler Rosey
Patti/Skyler Rosey

Oooooh a handsome derma checking out your body mmmmmmmmmmm nice… reality check: oh great glad all was fine. I get those also and have had a few removed.

My derma is a woman *sigh* :p

Pegasus
Pegasus

Latest news on MH230 is it is official that it is a hi jacking, so those you thought passengers were still alive were right.
No demands made yet, and no idea of where landed.

calypso
calypso

I wonder if the Virgo Full Moon will illuminate things?

starlore
starlore

For those interested, this woman thinks that the plane was shot by a new laser energy weapon that the US have.
http://www.youtube.com/watch?v=aUgWhUkkzr4#t=94

Who knows? My sense is that she is right though.

starlore
starlore

By the way, whether you believe her or not is obviously up to you, and I certainly really don’t know what is going on.

But one of the main points in the interview is that there is a media war going on, and I couldn’t agree more.
True and accurate information is power.

starlore
starlore

This is the promo video that the US Department of Defense released on the 6th of March, showing their new toy:
https://www.youtube.com/watch?v=Px87SP01eKw

But again, who knows !

sweetpea
sweetpea

I didn’t watch the whole video but interesting what one of the posters – Steven Gaylord – said about the patents for the technology.

Astrologically, on another site, a chart was done for when it went missing and it shows Neptune – the ocean – at the IC – endings. “A mysterious ending” is how someone is calling it.

sweetpea
sweetpea

I was referring to your 1st link above.

Of course there has been nothing, absolutely nothing on mainstrean tv here in the states about the tech people.

Scorporation, Inc.
Scorporation, Inc.

Yes, this was my 1st thought when the plane went missing: Neptune ate it.

calypso
calypso

actually i think that’s really profound Sweetpea, Neptune at the IC, it is hidden from view, etc. I hope it comes back into view with people intact. My friend when she thinks of it has a vision of a field, like it’s landed somewhere isolated.

Seabird
Seabird

Glad to hear you’re ok, Myst. ‘Tis the curse of us white Aussies. When I married an African bloke my dad said ‘are you trying to improve your gene pool?’ Not consciously then, but looking at my now 10 year old, um, yes. It does feel very much like life will never be the same again over this way. No matter what I do, in the last month, it’s all gone topsy turvy. In a good, weird way. As in: that’s not working any more because its being replaced with…. THIS! (Insert weird, strangely wonderful opportunity or angle which seems… Read more »

cosmic fleece
cosmic fleece

Proof of the benefits of an every changing lateral thinking Gemini mind ! I pictured you with a magicians wand whilst reading complete with ”poof” magic cloud, at ”insert new idea here”.

Chuffed to read you are really in love now Seabird. x

12th house virgo
12th house virgo

Yes, perhaps things are going terribly confusingly right in the zap zone. Funny because I think my brain fog struggles with this. It isn’t what I thought is should be, but it isn’t bad at all.

Nightrose
Nightrose

Speaking of dreams above, I had a dream I gave birth to a child this past week. I think Ive had a pregnancy dream before but this time I actually delivered, and I felt the baby coming out while I was supporting it out of my hoo-ha. Does the gender of the baby have any importance?

Anybody have dreams of this nature before, and did anything occur?
Supposedly this dream means that there is a whole new start or new aspect of life that will come around.

Scorpbot
Scorpbot

anything happening in your 5th house? – creativity, love, babies…

What have you just given birth to?

Maybe the gender refers to male/female aspect of yourself – anima/animus.

Haven’t had a pregnancy dream since my 20’s! And i never actually got to the “birth” part. Hehe

Nightrose
Nightrose

Hehe I’ve actually got Lord of Duty and Ultimate Taskmaster – Saturn – in my 5th. Interestingly enough, I haven’t felt this fertile, in more ways than one, in a very long time. For some reason the concept of pregnancy – metaphorical and literal – have been floating in my psyche since last year. If I were in a sexual relationship I strongly feel I might have been visited by the stork by now. Yikes. I’ve done some intense vision/dream boarding lately, really have been super focusing on my wishes, vision and intent for the last couple months. Maybe it’s… Read more »

Scorpbot
Scorpbot

ahh, that could be it. Hopes and dreams coming to fruition… Saturn making it “real” ๐Ÿ™‚

Hm.. just realised “hopes and dreams” is an 11th house thing and opposes 5th. So you might want to have a look at that house too.

sweetpea
sweetpea

I had alot of birth dreams when I was new on my spiritual path or put another way “finding myself” or excavating my psyche. Sometimes I was looking for a place to give birth, sometimes I was diapering a baby. I remember one dream the diaper was too big and so I concluded that meant that I was growing into something. One time the baby was upset because I was weighing and measuring her. In that case I concluded that she did not like being judged. Nightrose, I too have trans Saturn in 5th right now and so you remind… Read more »

Scorpbot
Scorpbot

thanks Sweets. Just following my bliss. ๐Ÿ™‚

Veronica
Veronica

Scorp, answering down here for space, am a snake year.
Know a few dragons, and they do melt in front of tears ๐Ÿ™‚

And Cancerians do totally get scorpions. I sometimes think they are tougher in a strange way, at least they are with scorps, from my observation. But a beautiful pairing when it works.

Scorpbot
Scorpbot

yeah I know it’s supposed to be a beautiful pairing but personally it doesn’t work for me. Water + water = drowning. Besides, Cancer is opposite my Cap Asc and squares my Saggo moon. I’m an open book and don’t appreciate the Crab’s pass/agg behaviour and propensity to withdraw. Let’s talk it out honestly and with candour!!!! And I despise being emotionally manipulated.

I don’t think he got me at all.

Nope. No more Crabs for me! No sir-eee Bob ๐Ÿ™‚

R(aqua/ tauri)
R(aqua/ tauri)

Don’t even have time to sleep let alone comment these days. Will be back to more normal schedule (well…previous normal + Mysore at 5:30am daily so maybe not really) next week and looking forward to routine again. I want to shed…strip down to what’s essential and be ready and welcoming to something new and wonderful. Today I had a facial (with intense extractions), a rolfing session, bought a million beauty products, and deep cleaned my house like never before. Virgo vision. Leave tomorrow for just 20hrs. I just want to be detached. It’s a blip to scope something out and… Read more »

Blue Moon
Blue Moon

Awesome Virgo detox zap zone prep work Rachael.
Super impressed!

davidl
davidl

The first 3 months of this year have been difficult, strange. As you describe Myst somehow work was really busy pre Xmas lately hard to find or hard to deal with. It feels a little like the lo types are dominating right now. Power shifts and reversals all around. In Australia the change of government from left leaning, kind and a bit dumb to right wing, austere and ruthless has begun to create division and anger in the community and amongst friends. They are currently breaking down, dismantling this country and it’s values. The damage in 3 months of a… Read more »

cosmic fleece
cosmic fleece

Dear David,
2 Rams with blow torches always better than 1.
See you there !

Hey D, it sounded like earlier in the year that you were losing a layer of ye olde onion skin, .. and stepping more into a mentor / wizened man role.

Peace. x
I didnt comment i’m afraid, i came to the party a bit late, and well, *scuffs shoe…. i thought peeps thoughts and thinking were ont he same tracks as mine, so left it. you were in my thoughts.

davidl
davidl

Thanks for caring Cosmic x yes shedding that one has been tough and while it’s been shed, I’m still filtering the data. Still trying to distill the essence of it. Mystic explained it was the Saturn return of the time I have been pondering. I’m still being taken there, being asked (forced ?) to look . The question ? Was anything lost ? Is anything that was lost meant to be found again ? Most of those questions have been answered but it’s slooooooooow. I’ve had the match lit, ready to burn it all but somehow the match gets blown… Read more »

davidl
davidl

Love lost, such a cost
Give me things that don’t get lost
Like a coin that won’t get tossed
Rolling home to you

Veronica
Veronica

Speaking as an Arian who is feeling the financial pinch of Mars retro,added to a general frustration, anger and sense of impotence over the state of local politics, your considered overview here gives me a strange peace. Thanks!

And I do actually like the notion of the zap zone as a broader scale of change.
Viva la revolution!!

davidl
davidl

The way you write V always settles me. Your a clear thinker in a way that makes me feel like I know you and you me. If your art does that then your exhibition will be a huge success x

Veronica
Veronica

We could very well have been in around each other in Surry hills and Balmain, back in the day D, from the sounds of your stories.

Am a few yrs younger, but a similar journey, searching WAY off the beaten path, with some of the head and heart bruising that comes with Aries style learning…back to tell the tale, I suppose.

Scorpbot
Scorpbot

Completely unrelated… I had a dream last night about my muse/crush – Libran artist/barista. Weird, because it’s not like I see or think of him regularly but have had several recurring dreams were we bump into each other, say hi and move along. But last night we sat down and had a long chat and he placed a few small black stones on my head. Is that the crown chakra? What does it mean??? ๐Ÿ˜ฏ

Nightrose
Nightrose

Just a guess, but Grounding?? Is he “grounding” your “vision” in some way? You say he is like a muse, maybe he is helping to shape or materialize things you see or think into reality? Either way seems like a very interesting omen ๐Ÿ™‚

Scorpbot
Scorpbot

Grounding….I like that!!! ๐Ÿ™‚ Reading up on crown chakra and mine is definitely balanced… so i think. LOL. But I’m a natal Neptune conjunct Sun person, so can get lost with the pixies… ๐Ÿ™‚
Stones would ground that.

Also, according to one site “Frankincense and rosemary” are oils associated with the Crown chakra. Interesting… I was walking past a crystal shop last week and they were burning the most amazing Frankincense – an Osirus blend. Walked in and bought some. Have always loved Frankincense!!

Nightrose
Nightrose

Yaaaaayyy! I love going to crystal shops. I literally start buzzing – I can hear and feel it throughout my body – when I visit! ๐Ÿ˜€

Scorpbot
Scorpbot

Ok….. “The crown chakra is the gateway to your own true Self, and working with this chakra can guide us towards self-realisation (or what Maslow called โ€œself-actualisationโ€). When our true Self manifests in this world, we have reached our highest (in this life) potential and unified our personality as a whole”

Maybe he’s helping me reach my true potential. He’s already where I want to be in a few years time with regards to art.

He’s my inspiration (his Neptune conjunct my South Node) … from a past life perhaps.

His Sun on my venus. My venus on his sun ๐Ÿ™‚

Nightrose
Nightrose

There ya go ๐Ÿ™‚ He is helping you ground your vision of potential or whatever takes up space in your crown, as your muse. I cant help but think you must be inspirational to him too. Lovely. Enjoy the connection ๐Ÿ™‚

Scorpbot
Scorpbot

well he did “like” a pic of my little sculpture on Facebook this morning ๐Ÿ™‚

Veronica
Veronica

straightaway made me think of the black stones to sever old relationship cords that was mentioned a few posts back?

Seems like he might be helping you get ready/clear the way for someone significant to come

Veronica
Veronica

Or something significant to come! ๐Ÿ™‚

Scorpbot
Scorpbot

yes! that too!

I decided to finally give the Kataka guy the flick on Friday. I was seeing him causally for sex once a week but he’s SO ANNOYING and such a Qi vampire, it just wasn’t worth it anymore and it was really bringing me down. I’m a Scorp with Eros in Scorp too. I can’t do light and “causal” unless it’s one night. It chips away slowly at one’s esteem.

Thanks V! x

Veronica
Veronica

Well I’m totally feeling something haute coming your way, what with the other dream of the world card, and you being profoundly dong something you love now.

The Katakana is old regime, not inspiring you really, is he?

Veronica
Veronica

*doing* something you love

Scorpbot
Scorpbot

“not inspiring” LOL. That would have to be the understatement of 2013!! He’s so simple. Same boring job for 20 years… no ambitions. Ugh. You think a Cap riser like myself is going to find that inspiring? LOL. And he’s LAZY!!! (Jupiter in Libra in 6th house) and always late. That was the final straw. My Mars in Virgo doesn’t have TIME for slackers!! I don’t mind peeps being 10-15min late or even half an hour but one to two hours EVERY time. It’s fuqing ridiculous!!! Turned up at 10pm last time then showers and shaves at my place. Can’t… Read more »

Veronica
Veronica

Oh that lateness is SERIOUSLY not respecting your time. And very Pass Agg on top of that.

No no no no, you need a situation that makes your heart sing, that is where you are at in your journey these days.
Not seething with annoyance…

scorpy
scorpy

yep, “seething” is the word. And of course one can’t have a proper discussion with a low Cancer conjunct mars person because they get defensive, then pass agg. Then they get sooky and retreat into their shell and guilt you into feeling sorry for them. Because usually they are sweet, adorable and caring but they never ever apologise or admit they’re wrong – everyone else is the baddie. And then you feel sorry for them and give them another chance and another and then one more and before you know it, they’ve sucked you dry!!!!!!! When i told him Friday… Read more »

Victoria
Victoria

Yeah, well they say that year of the dragon people
(such as
yourself ) are lucky, and indomitable, except the chink in the dragon armour is if they feel sorry for someone…just beware your sympathies being manipulated ๐Ÿ˜‰

Scorpbot
Scorpbot

hmm. Interestingโ€ฆ didnโ€™t someone here say that Crab men are Scorp slayers? ๐Ÿ˜ฏ

And I was like – “not me!โ€ because I never fell in love with him but I guess i fell for his sookiness. He has a grand water trine too – things always come to them without trying.

Youโ€™re a Dragon too arenโ€™t you? Or Snake?

sweetpea
sweetpea

He should have been showing up spit spot, on time with bouquet in hand.

sweetpea
sweetpea

With the fling with the Libran years ago, he at least broughbt the Astrolube

๐Ÿ˜†

Over the phone he said (like a good ex huband would…he was divorced)

“do you need anything from the store?”

Sure, a gallon of milk and some Astrolube”

haha

calypso
calypso

I would say it’s more about clearing than grounding the crown chakra, but otherwise agree, it’s opening up your awareness and the link to him points to it being for your art ๐Ÿ™‚

Scorpbot
Scorpbot

Maybe i should Feng Shui my vagina when i burn the Frankincense. ๐Ÿ˜€

calypso
calypso

why not! the root chakra might benefit from some attention – for balance, you understand ๐Ÿ™‚

Scorpbot
Scorpbot

LOL. ๐Ÿ˜›

I’ll give it a whirl. See what happens.

calypso
calypso

it’s defo a good idea actually, cos there’s your grounding – if the black stones do activate your crown chakra that could make you really drifty and “light” if that makes sense.

you know I have heaps of earth in my chart, and recently my guru told me to draw in violet (colour of the crown chakra) from the light around me as I was deficient.

Scorpbot
Scorpbot

yeah makes sense. Could do with a bit of grounding. I have plenty of earth too but you beat me with your Toro moon. I’ve been too flighty lately. Art school is activating my Saggo moon – so inspired and heady. And retro Mars Libra keeping my 9th busy!!. Still trying to get into a routine (it grounds and keeps my Mars in Virgo happy) but the course is so intense I’m running around like a headless chook trying to fit everything into a day! Exhausted just typing that! LOL

calypso
calypso

hmmm, maybe the black stones ARE for grounding!

it was Mars Rx that stuffed up all my ambitions the other day I reckon…it’s coming back into close range of my Merc/Jupe. Also, Mercury has been exact Sq my Neptune – I’m looking forward to early April when that turns into a trine….

Scorporation, Inc.
Scorporation, Inc.

Are the stones for your undies? Maybe he was coming on to you… ?

I love love love the Franki too. Images of your incense wafting about has me in the mood for a bit of retail therapy, Scorpbot ๐Ÿ™‚ Sounds wonderful. xx

Scorpbot
Scorpbot

LOL. ๐Ÿ˜€ nah, don’t think he was coming on to me.

Found out this morning on facebook that he’s moving to the Netherlands with his wife.

I feel sad. ๐Ÿ™ (got PMT) I hope I meet someone one day that I can travel with. I’ve always travelled alone which has been great but it would be nice to share the journey with a partner.

Might save the Franki smoking ritual for the next New Moon. Must remember to disconnect the smoke alarm first. Haha

catfish moon
catfish moon

I’m pissed and on edge…….Natal moon in leo, but although the moon has moved into Virgo, that means in is in my 1st house.

I am over my boyfriend and son’s relationship. My son has been difficult true, by I have had it with my boyfriend cause he does not see what I see, doesn’t have the relationship I have with my son. ugh…..

Pegasus
Pegasus

As a retired (or on hiatus) frequent flyer, am also totally intrigued by MH320. Another Philadelphia Experiment.? There is a Bermuda Triangle type atmospheric phenomena close to Indonesia, below the Celebes. Couldn’t have landed without a radar noticing. Ocean not as deep as Atlantic where it took ages to find a missing flight a few years ago. A Malaysian Minister on TV stirred my loins, watching him speak & his smile reminded me of a past lover when living there. Saturn & bones. Podiatrist for me, pinched nerve in metatarsal creates excruciating pain in 2 toes. Helped by a dome… Read more »

Pegasus
Pegasus

Of course, forgot about the sic-fi peeps on board from a Texas Corp that was designing invisibility cloaks.
And Calligraphers!!

Germanic skin is not very susceptible to skin cancers and the more greenery in the area the less harmful rays absorbed, of course anyone can get skin damage from Sun, so i am forced to believe, strangely, the more humidity, the less damage is what been observed.
Have had that inspection, yes, Virgo’s & microscopes ๐Ÿ™‚

Sue
Sue

This aircraft disappearance has become borderline obsession with me too – it feels weird!

Tansaway
Tansaway

I also had a feeling it was something more than a simple ‘disappearance’…
Wonder if this plane will reappear right around 23rd April, when the zap zone cardinal cross is exact.. Interesting times!

Nightrose
Nightrose

The MH370 event is definitely part of something bigger. It seems everybody is either going nutso and/or cannot upkeep their false masks anymore. Ive come across several instances recently where I just realized who/what I was really dealing with after getting the vibe they were something else before – to clarify, their vibes, not assumptions of mine bc I dont hold ppl to my assumptions, if that makes sense. I know this information comes to me for a reason. If this is already playing out in my little microcosm here then its not surprising it is also playing out in… Read more »

Sarah
Sarah

Oh so it’s not just me who lost her shit at work …. I know it’s part of my job to deal with divas but last week was just plain evil …. Last week struck this Capricorn to the core … Thankfully I have such supportive coworkers … The abusive behaviour of those not happy with there lot and those not helping themselves is grown larger as this ZZ approaches …. I’d be lost with out MM’s pep talks and reassurance that I am on the right road managing this ZZ … Keeping your vibe high and self nourishment is… Read more »

Ariel
Ariel

Love you Mystic, & glad to hear you’re OK! Thank Goddess we have you to guide us through the Zap Zone!!

earthkat
earthkat

the oracle told me i need to work my midheaven…what is the midheaven?? (sorry for obvisouly silly astro question)
got the eyerols today for talking about astrology. in other news i would feel overwhelmed if i had time to. feeling surreal about time moving at crazy high speed.

Andromeda
Andromeda

“The Midheaven is the cusp of the tenth house, and is often represented in its abbreviated form: MC.” It’s the area around your professional life, work, things Capricornian.
Read Cafe astrology, it is really helpful earthkat. ๐Ÿ˜‰

kat
kat

thanku andromeda! im going to get on that ๐Ÿ™‚ xx

Charles
Charles

I have been geeking out over the current astro calculations. It looks like we are just coming off a Supermoon peak, and are now at Mars Max and Venus Max. And right this very moment we are at Mercury’s maximum elongation, in the midst of a Mercury Max cycle. I think we are maxed out. And now we are approaching the last Full Moon of the celestial year, the last Full Moon in Pisces. I did not think of this when I recently located a copy of Dion Fortune’s novel “The Sea Priestess” and started reading it. I expected a… Read more »

Quadruple Pisces
Quadruple Pisces

whoa, just started reading the preview of that book available on google. So good! I had never heard of it before… thanks for the tip ^^

Veronica
Veronica

Yes to the devolution hoping this leads to fab new evolution :/ I have only been called by work twice in the last 7 weeks where usually there would be steady cash flow by now. Am living in a new region and want to get called in by Quality new employer – had an interview, but just waiting, waiting, while the big bills come in, I bite my nails and I pay off sections where I can. On the other hand, every day up at 6:30 painting for my upcoming exhibition in …April… just after the first eclipse, and my… Read more »

Andromeda
Andromeda

Painting exhibition! That’s awesome – nice disciplinary effort V.
And awesome news re yr guy. Dare I ask what area he’s working in?

“Virtual office conversation” for the self-employed! That’s gotta go on the testimonial page. ๐Ÿ™‚

Veronica
Veronica

๐Ÿ™‚ He is a tradie, Andy, though not named Gary! but he has used Gary as a running joke/nom de plume way before he met me!

He dropped out of studying environmental science because the chemistry and pure math was too much to get his ADD head around after 15 yrs out of high school, which is a shame because he is a natural with all things earthy and outdoorsy, but is liking what he’s doing now, travelling to far-flung locales and building/fixing things (saggy moon)

Andro
Andro

Sounds great to me too! I do love Saggie qualities, he sounds fun. As an ADD-er myself I am quite interested in the topic! My Dr. recommended drugs but I know someone who started taking them, felt so in control of their world, they shifted 25 kgs, personality became delusional & ego- driven, etc. divorces, bridges burned yada yada kinda put me off.. Outdoors & earth are great for us Adders. ๐Ÿ˜‰

Veronica
Veronica

Oh definitely a lot of fun, with the saggy moon and Neptune, he makes me cry with laughter just when it’s all getting too serious and I get all Scorp moon on him. And extremely perceptive of emotion and nuance in people’s behaviour. the ADD was very difficult for him during schooling and just sitting still in general. Some days he walks around and round through the two doors of our house, making mess as he goes when not focused…he needs exercise, I think physical exertion is meditative for him. doesn’t read much, definitely not as eloquent as you in… Read more »

Blue Moon
Blue Moon

Oh gawd I’m almost exactly like him. Was on Ritalin as a kid which only exacerbated the symptoms in later years. I find exercise is the only cure for my ADD too. The amount that just going for a run helps is mind blowing. Totally relate to everything you said about him. Feels strangely comforting to read actually. Those similarities were striking . Thanks

Veronica
Veronica

You guys are like Djinns…whirling dervishes ๐Ÿ™‚

Difficult in childhood though, cos regular educational structures esp in those days were not as flexible and absorbing as would have suited your learning style. School can be a bit of a cookie cutter production line unless you happen to strike a creative teacher.

So one can waste a lot of time as a youngster feeling that something is wrong with oneself, when it’s actually that you are not being challenged the right way

Scorpbot
Scorpbot

Sounds fab Veronica ๐Ÿ™‚

Veronica
Veronica

It is good Scorp, but a bit scary, not really in control of how this is all unfolding. 0_0

Though control is an illusion, they say. So I just keep painting

Scorpbot
Scorpbot

that’s it… keep on keeping on. ๐Ÿ™‚

totally understand!! An artist’s life is one of uncertainty. I’m learning to embrace it. Not easy for a control-freaky Scorp. LOL.

Scorched Earth
Scorched Earth

Yeah.. that’s how I’m feeling. Totally scorched and mostly all work related. Gah! People who can’t man up and do their job then want to make it about me and when they do…oops they just leave out a component of the story that is relevant to their own behaviour and contribution to the whole. FFS. The daily grind is crazy enough (literally if you subscribe to generalisations on mental health) without having to do the eggshell walk around newbie Pisces colleague with a one dimensional view of how it is. It just isn’t the arena to work in if you… Read more »

Andromeda
Andromeda

Ay, there’s the rub, “the point where it crosses over from whatโ€™s external information to how it marries with internal belief constructs”. The internal belief construct is easily overwhelmed and then has to reject information to protect the mind. How much can we handle becomes the question, though when we start, it’s all ‘Now what’s the most logical scenario?’. Our standard for judging what is a ‘reality’ is actually the mirror of our personal abilities – of what we can handle without becoming rigid (through fear/excitement etc). Fear = obstruction of flow of energy. Chi. Anyways, I don’t even understand… Read more »

12th house virgo
12th house virgo

I’ve thought about what conspiracy theory means a lot. To me, its when there is a claim that facts aren’t just missing, but that someone knows the story and is perhaps even controlling it. As much as no news source is to be trusted completely, no story is the full story. So, oddly, this means that conspiracy theorists believe more in control. They make the things that don’t make sense, like a massacre in an elementary school, make sense, it was a plot of some sort or another. And since facts are missing, the plot can be anything and be… Read more »

12th house virgo
12th house virgo

Conspiracy theories oddly cramp out doubt and exploration of the unknown in this way – by claiming to explain the unexplainable and making the explained explained again with a twist. Doubt, uncertainty, unknown are all important things to accept.

Andro
Andro

Suppose it depends on if you actually believe in a ‘conspiracy theory’ wholeheartedly or not then… I don’t trust any news source. So in my case I entertain the possibility of differing agendas or collusion possibilities but actual belief is another matter! Agree that many people who adopt conspiracy theory at will are ones who believe we are ‘controlled’ because they need a system to operate within – any system, even a less than positive one. That’s how religion has survived so long afterall. ๐Ÿ˜‰ Hey, 12hv, I have Neptune in the 6th – I think this is interesting, a… Read more »

Centaurus
Centaurus

Like the way you said what you said Andro.

Centaurus
Centaurus

We might have differing views (point in case) on what a conspiracy theorist is. It’s too closely aligned to alleged whack jobs and nutters and students who shoot up schools for me 12V. It’s become distorted over time as well as a description. It is essentially someone who thinks one or more people are concealing information, evidence etc or secretly planning something. Well.. when I think of it that’s what I think of … loosely and I don’t necessarily subscribe to it. Still, we find evidence appearing later that fills in the gaps all too often and this Pluto transit… Read more »

12th house virgo
12th house virgo

Lots of crazy types are into conspiracy theories, so, yes, there is an unfortunate association there. Because to claim to know the “real” story when that “reality” is a person or group’s head, where it can’t be disputed, is crazy – and this kind of crazy parades as all SORTs of things, not just conspiracy-ists. Religion. Dogma. There is an association to conspiracy and crazy and I saw it in my father who is paranoid delusional, so perhaps I am extra cautious here. Some stories just make sense even if they aren’t mainstream. But, I saw this with Pisces too,… Read more »

Andro
Andro

That image is like Kwan Yin farewelling the human race as a nuke is deployed or something.
If only Monkey would arrive on his pink cloud to save the day!

Where are the human-animal hybrids with superpowers of yore gone?

leogroover
leogroover

yeah andro where is monkey?

Scorporation, Inc.
Scorporation, Inc.

With Venus transiting my 12th, I find your vision of this futuristic image as that of Kwan Qin so beautiful, Andro!

gren
gren

The office space is a freak show. My boss got let go due to her obsessive coke and ever clear bingez. The whole place has become dysfunctional inc. and the work bitches are on defcon pyscho.

Looks like I’m gonna get my director position, but at a cost. The stress overload of Phoenixing a lost department is getting to me. I’m prepped as shit but still drowning.

omnesensual
omnesensual

aren’t*****

omnesensual
omnesensual

De-cluttering like there’s no tomorrow! Turning the tables and all. As for the aircraft 1st thought: it was STAGEd to look like an attack( been a while since “they” had a reason to wage war on terror while looting oil & opium to further the war; 2nd thought: space/time continuum glitch ala doc who and time war; THEN i read something about 20green energy experts being on board. I gather this is the electrical weapon guys. It is all sounding scary. Any of these scenarios are plausible in this piscean dream, but we can be certain whatever the real answer… Read more »

Andro
Andro

General Starzinstripes: “Now how to keep face and distract while we get those skills from those intractable Weapons guys in time for Russia/Ukraine.. What was that Lost series premise again? They’re where? You know the Andaman Islands have great diving this time of year…”.

There really should be an Alien in there.
Yeah, no clue.

Libra9
Libra9

Have done years of prep for this Zap Zone. Feel entirely fabulous. Work great. MM giving great advice daily. The plane is fascinating. I think it’s Vlad as it’s taken the spotlight off Ukraine.

david5379
david5379

If it did get hijacked then it sounds like the plot of a Shane Caruth movie geez.

Emg
Emg

Firstly the thing about professionals struggling etc. Vote 1 I can vouch for this totally. Career has been a nightmare for me for the past few years but hey that is pluto in my 10th opposing all my cancer homie stuff. As to the aircraft. It didn’t register on my radar for a couple of days, then I heard that they still hadn’t found it. And my instant was uh huh. This isn’t just a downed craft. This is bigger. But apart from that I don’t consider it as just yet there is nothing I can do. And until there… Read more »

Blue Moon
Blue Moon

Pluto in tenth house too. As are all my Virgo planets!
This full moon feels very “career threatening” I’ve purposely not mentioned something else re career since dude who that involves stalks me on here. If it wasn’t so depressing I’d find it hilarious. Get over yourself Blue. ๐Ÿ˜€
But I feel you 10th housing away with this full moon in Virgo
Do I EVER!

Virgo Ellie
Virgo Ellie

Interesting about the entire post! (1) Work.. yes.. I will hold on loosely. A co-worker / close friend was just let go. He and I use to chat a lot about the poor management at the company. I told him to get ready so many times. Every day I walk into work thinking I might be let go. So, he is gone and a couple of days later while meeting with my boss she confirms with me the goals I want to reach. More responsibility, challenges and learning more so that I can help her. Things are definitely shifting. I… Read more »

Virgo Ellie
Virgo Ellie

Oh.. PS: Very emotional and tired last night and today! At work I got to hold a 1 month only baby.. My co-worker brought him in to meet us all. I am crying my eyes out! Such an innocent soul! WOW…

During a Dark Moon we feel emotional / tired.. we need to rest and rejuvenate, I think, right? But when does this Dark Moon shift? Does it shift when the Full Moon hits Virgo on Sunday? (sigh)

12th house virgo
12th house virgo

It isn’t a dark moon, Virgo Ellie. The dark moon will come at the end of March. It just feels dark now. Not sure why.

Virgo Ellie
Virgo Ellie

Ok! Thanks!

pi
pi

MH370, me too mystic. I tend to carefully set aside stories like this but I can’t help but feel people are alive. You know?

Equilibrium Girl
Equilibrium Girl

Yes!!! I just can’t get rid of the feeling either. This latest news that they’re looking waaaay to the west just strengthened that inexplicable, illogical feeling that people are still alive. How a jet could land anywhere without notice though… As I said, illogical but that weirdy vibe is so strong.

China, Pakistan, North Korea – who knows who’s behind this so maybe someone has taken the plane in on a private base/ airport??? So many theories. So little information. So much sadness that’s probably going to come.

Universali
Universali

Me too!! I really have a big feeling that the people are alive and the plane landed somewhere just fine. It is way too weird, the false passports, weapons experts, the patent on some amazing new energy….a plane doesn’t just disappear anymore! I’m obsessed with this story.

Blue Moon
Blue Moon

I haven’t been sharing the past few days because there is just so much going on I don’t even know where to start. This full moon zap zone is shining its bright light on so many areas of my psyche I’d rather not acknowledge. I’m guessing soul searing honesty with self and others is the way to go. Evolution via conscious hardcore effort seems to be the only option right now. I do feel as if I’m pedalling hard on a bike up a hill in the scorching heat when I’d rather be floating in a familiar, dark pool in… Read more »

12th house virgo
12th house virgo

“Iโ€™m guessing soul searing honesty with self and others is the way to go.”

YES PLEASE! I know its hard, but please be real. For yourself, for others, for all of humanity, we need you as you *really* are, strong/vulnerable/confused/knowing all that.

Blue Moon
Blue Moon

Thanks 12th House Virgo You must be feeling this Virgo full moon hardcore too. Been reading your posts and I totally agree re Pisean man. Just be gone already dude. Stop fuqin with my head. And your lil girl. Like swim away already and let us move on from you and your constant drama! Like you say, send us a post card from wherever. But go now. I got pissed off with him when you said he told you you were “the only one who understood him”. Like how many manipulative ploys does it take to make this dude look… Read more »

Blue Moon
Blue Moon

ML was just super sweet despite my being completely incoherent the first night of our stay together. By the time he’d gotten to the hotel I was a complete mess. He didn’t say anything. Just put me to bed. When I apologised for “last night” he just shrugged it off as nothing. “Oh you were a little drunk. That’s all. I was a bit worried since I don’t know you like that. What happened to my minimalist, zen, super fit awesome gf?” He laughed. “A bit drunk?” I said. “I was practically comatose!” I laughed.. “It was pretty scary.” He… Read more »

12th house virgo
12th house virgo

I had a dream last night that I was having sex with a guy in a bathroom stall and I told him I wanted to pee first, but he wasn’t waiting and it felt nice, but still, and there were two men outside the stall, one cop, one military, so I felt like I couldn’t really leave and it felt good, so… Those three men pretty much sum up the Pisces. I got visions of how it would go before it started. He lives like a clenched fist trying to control things he can’t control. That’s the vision – the… Read more »

Blue Moon
Blue Moon

Thank you 12th house. Yes I do. I know. It’s my power and I have to step up and claim it. Not go via some man who’s in love with me and collect ยฃ200 in the process. Oh so south node in Kataka 8th house no? Lol Which also happens to be where my progressed moon is now, Hey Ho. Onwards and upwards. Dreams and reality seem to have blurred into one confusing brain fog but hey, I blame my “suicide by minibar” adventure for that. Hey at least I can say I did it right? No need to repeat… Read more »

Blue Moon
Blue Moon

Maybe your dream gives you some key as to the lesson or alchemy of this experience ?

12th house virgo
12th house virgo

Most def. I think he and I worked a lot of our past romance wounds out on each other with our Venus-in-Cap romance. There’s value in that.

I’m going to take a long bike ride ๐Ÿ™‚

12th house virgo
12th house virgo

“Dreams and reality seem to have blurred into one confusing brain fog” YES. Exactly. And its amazing that its true for all of us – airplanes vanishing and all – into a confusing brain fog. To Prowlin Crab its boredom, to another its exhaustion perhaps. But it seems larger than Us, yes? And there is an odd sort of comfort in being out of control together. There is so little we control here. I have decided to quit drinking next. I control that much. That’s a quick way to improve nutrition.

Blue Moon
Blue Moon

Oh god totally. I feel that needs to happen in my life too. When I was body building competitively it wasn’t a part of my lifestyle apart from very occasionally but in SA everyone drinks like all the F ING time and yeah it’s crept into my lifestyle too. I don’t like it at all. Feels extreme to STOP altogether but also right in a way. As if straight edge might just be the way forward for me. I want to focus more on yoga and NC – without wanting to sound woo woo wholistic health is just so much… Read more »

Airess
Airess

Oh Blue Moon, im hearin’ ya. We have so much in common re the angelic ML… I totally get what you talk about… would be fab to share experiences over a beverage. But from memory you’re in the UK no?

Blue Moon
Blue Moon

Normally I am, although right now I’m in Madrid. X

calypso
calypso

sorry Blue, but are you saying the Spanish guy you’d never met who contacted you out of the blue and offered to build you a website for nothing actually turns out to want something?

I’m sorry this is causing you grief atm, but it’s probably also a useful penny to see drop x

Blue Moon
Blue Moon

@Calypso TOTALLY !!! That was MY FIRST THOUGHT when I read the email. I actually wrote back, “never believe whores who say they don’t want money. What they mean is they want MORE money. Much more!” It’s a Timothy Leary quote from that Sunblock Song. Yup. Pennies dropping so much in my life right now, it’s like its raining pennies! Which can hardly be a BAD thing. Just need to channel it. But YES! Exactly. And well spotted btw. How awesome of you to pick up on that continuity. Met up with him last night, just for a talk. Am… Read more »

calypso
calypso

yes, absolutely, I’ve given up booze, dreamweed, ciggies, men – in that order, and well, for now – but not coffee, nuhuh, coffee is the last thing to go, even though my adrenals have been shot ๐Ÿ™‚ yeah, I just remembered when you first mentioned this having a little antenna waver in a danger-Will-Robinson way. I remembered you said you were going to insist on paying him which I thought at the time was a good idea but now it looks more like you still get manipulated but with the added pleasure of paying for it! Anyway, may all the… Read more »

Blue Moon
Blue Moon

Thank you Calypso Yeah. Learning a lot here. Things are not going well but am sticking with trying to resolve things while I’m here (in Madrid) rather than just bolting or even escaping via – we have some very expensive bottles of Spanish wine here in the flat and it’s clear that these tensions would be eased by booze or sex, actually both. I’m not exactly enjoying the conflict but staying present is a lot more appealing than taking a cop out and going retro on my own consciousness Yep I still do caffeine but only in the morning. Booze… Read more »

Blue Moon
Blue Moon

Ok well I’m still here at the flat in Madrid. With sulky pants in the living room and me in my bedroom. He has his own grand “master bedroom”. I’m amazed at how cool I’ve been. Quite impressed at my own tenacity and level headed ness re all this. Have tried resolving things several times. He’s not interested in resolution. Oedipal issues at play says my psychoanalyst friend (yes the ex) who’s been trying to make me see things from “a guy’s perspective” Yep. I’ve tried every tack from taking full responsibility for everything. Ignoring the invasion of my cyber… Read more »

calypso
calypso

blue, you sound like you need a chaos intervention! Your self-appointed literary critic’s Scorp Mars didn’t get what it wanted, watch the stinger, and frankly neither of you sound that rational in this scenario. How much would it cost you to identify the agent of chaos – whether it be him, parts of you or both – and walk away?

Blue Moon
Blue Moon

Calypso. I think you are right. Flight change would be more than I want to spend plus trains from the airport to my house are not running today. Woke up thinking. Just Go! Have looked into it. V expensive. Wondering if I will regret the additional costAND leaving without really doing everything in my power to resolve this compassionately, spiritually Really don’t know what to do. Leaving early will cost me a fortune, this trip already has so that would make it even more costly. Staying is no fun at all. Stuck in the middle with what is. Noisy, hot… Read more »

S
S

Thank you for your words about keeping the faith about work MM. My boss wants to hire more people and I am terrifed I am about to be replaced. We have a meeting set for Tuesday to discuss and I’ve been shut down everytime I’ve tried to get a heads up on things.

12th house virgo
12th house virgo

If the plane was hijacked, wouldn’t the hijackers have made their demands? I have never enjoy conspiracy theories. Even if they are right. Just because all that is totally out of my control.

Blue Moon
Blue Moon

I totally got goosebumps all over my body reading that.
Loved the image of you and the Virgo dermatologist.
Glad you are ok.
Yes.
That is EXACTLY how I feel right now.

12th house virgo
12th house virgo

I’ve been getting more work. Got a new project that’s near and dear to the heart of the CEO. He told me to take charge, which made me realize how wide open management is there. Launch of the new product is scheduled for end of April -eeek! After spending all day with me and Aries baby Sunday, the Pisces emailed Monday to say he’s moving back west to work on a rig. So tired of shifting extremes with him. It is *really* exhausting. Now he wants to schedule when to stop by and say bye. I tried being polite and… Read more »

david5379
david5379

You can look in to bodyweight workouts if thats the kind of exercise you need 12hv, you can stick with calisthenics and you will be decent and if you want you can even get gymnast-y about it and get really really strong from it, lots of range and you only need a pull up bar pretty much

12th house virgo
12th house virgo

Thanks for the tip – any sites/gurus/online resources/etc you can recommend? My goal is to have a food and exercise plan in place by Monday.

david5379
david5379

The book burn the fat feed the muscle as far as nutrition goes, best I know of. and there are programs but I usually ignore that stuff and just learn as much as possible and program my own workouts, I know enough I can find you a good one if you want. I would focus on just doing squats push ups and pull ups at first, if you just starting out normal calisthenics is preferable, depending on what your going for you could do something every day, or 3 times a week. I am going for muscle so its about… Read more »

12th house virgo
12th house virgo

You are too kind! I would like to build muscle. I know how to accelerate my heart rate, but not so much what to do to build muscle. They have a pull up bar in the park near my house. I can’t do one pull up. How do I work up to it? Just hang there with hands hurting? lol I will check out the book you suggested. Thank you!!xo

Veronica
Veronica

12HV, I have lost 7-8 kilos in the last 2 months, by drastically reducing amount of carbs, and taking in protein in some form every meal Went to naturopath in December, exhausted, bloated and possibly pre -diabetic, like my blood sugar not clearing fast etc. so motivated to stick to diet, as I don’t want to develop full blown diabetes, which appears in my family. I haven’t been exercising in particular, a bit of yoga, gardening and cleaning, I’m fairly active day to day. Lately been sitting at my desk painting. But five simple small meals, eg. eggs in the… Read more »

12th house virgo
12th house virgo

Yes, I used to do 5 small meals. I’ve been doing smoke, caffeine and alcohol since Neptune got into my 6th house. I hope reading a nutrition book will ground my grocery shopping. Meal planning, etc.

12th house virgo
12th house virgo

Ordered the book – its on its way! ๐Ÿ™‚

david5379
david5379

Okay I got bored looking so I’ll just fill you in. Muscle has tons of health benefits, in fact I don’t even remember all of them. Unless your roiding or something its basically unilaterally good, tons of mental health benefits and it increases your metabolism along with the fact it gives you a strength base to work out in even more hard core ways witch in turn burns more fat. It it good to have some fat(for girls especially), but beyond that healthy amount fat is pretty bad for everything. In fact after a certain point it starts coating/surrounding your… Read more »

david5379
david5379

also good form is important, try and do everything smoothly, and if you want to make one workout harder, do it very very slowly.
Pull ups always keep your arms bent, dont hang with your arms locked out its bad for your shoulders and stuff, also keep your core tight while you do them so you can stay steady and not rock back and forth all over the place, can’t think of any other ones where there is common bad form

12th house virgo
12th house virgo

got it ๐Ÿ˜‰

Blue Moon
Blue Moon

Hey this is great info. Thanks for taking the time to post it. Actually I agree with everything you’ve said so far!
It’s great to hear your passion for fitness and that you are so helpful.

david5379
david5379

thanks blue moon, everyone has fitness advice to give and I don’t think I have ever gotten good advice from anyone(in person) and on top of that unsolicited rants as a guy to a girl about fat muscle blah blah blah would make me look like a dick. So I tend to not really speak up about it unless someone is looking for info/advice. And actually ya I guess I am passionate about it ha, when I was a kid it just seamed obvious that one day I would be as fit as possible because why wouldn’t I be my… Read more »

12th house virgo
12th house virgo

THIS IS AMAZING!!!! The site was being weird last night and the comments displayed one after another so I only saw the second comment you made at the bottom of the others and missed this. THANK YOU!!!! ๐Ÿ™‚

david5379
david5379

Ya I included too many links so my comment had to await moderation ha. And to the extent this info helps I am really glad I could help, lots and lots of info out there and its hard to sift through it to find whats what, I have probably wasted a year and a half or so on bad information and I am pretty good at telling whats what and finding good stuff, so going in to it suddenly I can only imagine

david5379
david5379

also, that book has tons and tons and tons of info re nutrition stuff, you don’t have to follow all of it to the letter, just slowly incorporate it in at your own pace and take what you need, it was a lot of information for me to even take in and I haven’t started following all of it either

12th house virgo
12th house virgo

Thanks again! I am excited about working out at home using my own self. I like how in the videos the dudes are dressed regular. All these exercises can be a part of my day to day life! Ahโ€ฆfreedom! Its funny, its not like I didn’t know push-ups before, but I feel really motivated to make it a plan and your taking the time to share all the info and videos really helped. Thanks. As for diet, yeah, I will get there. Slowly, slowly.

david5379
david5379

So glad I can help 12hv ๐Ÿ™‚

prowlncrab
prowlncrab

Nup still not feelin’ it …. bored bored bored bored boooooooooorrrrreeed.

I hope that the airflight thing is suitably weird … I haven’t noticed anything scary or interesting in the world going on lately. Just same ol’ same ol

Leo-on-the-Rise
Leo-on-the-Rise

I agree with you Mystic – When I heard that a plane had “disappeared” from the radar I had a feeling it hadnt crashed – this plane has landed somewhere………It’s impossible to to lose a passenger jet with 300 people on board in 2014…….

AstroGeek
AstroGeek

Spot on. What’s even more surreal is trying to piece together the information from various US and non-US media sources.

Thanks for the head’s up on Zerohedge, Mystic. Looks like they’re becoming a full-fledged news provider and not just for financial insights.

Leo-on-the-Rise
Leo-on-the-Rise

Just read that the plane had been deliberately diverted by someone on the plane and flew for another 7 hours….I think it’s known where this plane is but there’s a news blackout……

Porkchop
Porkchop

Mystic, glad to hear you’re okay! I hope that it’s not terrorism behind the Malaysian flight. The world is getting too scary! That would make me really nervous about flying. I have been having dramas at work. there are two nitwits who have always hated our coworker (who I am good friends with) and now hate me for having the audacity to tell them that if they wanted to borrow my new employee they needed to ask me first. (i was uber pissed when i said it, but i didn’t say ‘i hate you, you stupid idiots!’ i only spoke… Read more »

freedom ala air
freedom ala air

Very quickly… I would say people do see someone self evolving much more interesting than a diamond ring! Or if you are in circles where this matters get your own, then watch the movie blood diamonds and tell all your friends to watch it too. Love your self evolving sista!

solanaJ
solanaJ

Yay for self-evolving! I really related to your comment. My recent ex was very into success and fast cars, and fashion, etc. He really was successful, and I was proud of him. However, a big part of the reason we broke up is because I am just not in that place in my life right now. Iโ€™m still trying to figure out who I am and what I want to do. I really wanted to be the right person for him, but I just didnโ€™t fit into his world. Sometimes it hurts when I start imagining him finding some hot,… Read more »

Porkchop
Porkchop

My ex has mars in leo and was always trying to look good to others and ‘prove’ himself. I would feel inadequate cause I wasn’t constantly trying to force things to happen in my life like he was. I have things I want to achieve and am working towards them but with not so much desperation. I find it much easier to make positive changes for myself without feeling like someone like him is looking over my shoulder, judging etc. I just feel freer to try things and be myself. Love that about JK Rowling! Most ‘failures’ and difficulties are… Read more »

Scorpbot
Scorpbot

“Most โ€˜failuresโ€™ and difficulties are trying to get us to get rid of stuff thatโ€™s not for us’

Love that. So true!!

Porkchop
Porkchop

Thanks! Yes, some people think self-evolving is more interesting than diamond rings etc (that’s why we love Mystic’s site! ๐Ÿ™‚ but it’s still the minority, I think. I definitely find it more interesting, but I feel insecure at times and feel something’s wrong with me cause I’m not doing those things (and no partner etc).

solanajess
solanajess

I get where you are coming from. My ex really cared about looking good to others also, and having a girl who made him look good. Now every time I turn on the TV and see a bikini-clad model on a beach in a commercial I feel like Iโ€™m looking at the kind of American dream girl that he was striving for… and that I will never be. It hurts because Iโ€™m still grieving him, but also because Iโ€™m realizing that itโ€™s not just him who wants that kind of American dream—itโ€™s what most of society wants!

Scorporation, Inc.
Scorporation, Inc.

I’m speechless.

Pfft no, not really. As if!

What gorgeous images, MM. This entry is like a hit off the cosmic bong, and I’m road tripping today so not cool. Will have to get back with you later when I’m cleared for takeoff.

Pin It on Pinterest